”When I talk, it’s not a rant. It’s a symphony of ideas” a study on the rhetorical devices in Kanye West’s speech

Bibliographic Details
Main Author: Vainio, Otto
Other Authors: Humanistis-yhteiskuntatieteellinen tiedekunta, Faculty of Humanities and Social Sciences, Kieli- ja viestintätieteiden laitos, Department of Language and Communication Studies, Jyväskylän yliopisto, University of Jyväskylä, Englannin kieli, English, 301
Format: Bachelor's thesis
Language:eng
Published: 2022
Subjects:
Online Access: https://jyx.jyu.fi/handle/123456789/81247
_version_ 1809902796270469120
annif_keywords_txtF_mv rhetoric symphonies rap music hip hop musicians
annif_uris_txtF_mv http://www.yso.fi/onto/yso/p563 http://www.yso.fi/onto/yso/p10247 http://www.yso.fi/onto/yso/p10871 http://www.yso.fi/onto/yso/p14336 http://www.yso.fi/onto/yso/p1644
author Vainio, Otto
author2 Humanistis-yhteiskuntatieteellinen tiedekunta Faculty of Humanities and Social Sciences Kieli- ja viestintätieteiden laitos Department of Language and Communication Studies Jyväskylän yliopisto University of Jyväskylä Englannin kieli English 301
author_facet Vainio, Otto Humanistis-yhteiskuntatieteellinen tiedekunta Faculty of Humanities and Social Sciences Kieli- ja viestintätieteiden laitos Department of Language and Communication Studies Jyväskylän yliopisto University of Jyväskylä Englannin kieli English 301 Vainio, Otto
author_sort Vainio, Otto
building Jyväskylän yliopisto JYX-julkaisuarkisto
datasource_str_mv jyx
department_txtF Kieli- ja viestintätieteiden laitos
faculty_txtF Humanistis-yhteiskuntatieteellinen tiedekunta
first_indexed 2022-05-24T20:00:30Z
format Kandityö
format_ext_str_mv Opinnäyte Kandityö
free_online_boolean 1
fullrecord <?xml version="1.0"?> <qualifieddc schemaLocation="http://purl.org/dc/terms/ http://dublincore.org/schemas/xmls/qdc/2006/01/06/dcterms.xsd http://purl.org/dc/elements/1.1/ http://dublincore.org/schemas/xmls/qdc/2006/01/06/dc.xsd"><title>&#x201D;When I talk, it&#x2019;s not a rant. It&#x2019;s a symphony of ideas&#x201D; : a study on the rhetorical devices in Kanye West&#x2019;s speech</title><creator>Vainio, Otto</creator><contributor type="tiedekunta" lang="fi">Humanistis-yhteiskuntatieteellinen tiedekunta</contributor><contributor type="tiedekunta" lang="en">Faculty of Humanities and Social Sciences</contributor><contributor type="laitos" lang="fi">Kieli- ja viestint&#xE4;tieteiden laitos</contributor><contributor type="laitos" lang="en">Department of Language and Communication Studies</contributor><contributor type="yliopisto" lang="fi">Jyv&#xE4;skyl&#xE4;n yliopisto</contributor><contributor type="yliopisto" lang="en">University of Jyv&#xE4;skyl&#xE4;</contributor><contributor type="oppiaine" lang="fi">Englannin kieli</contributor><contributor type="oppiaine" lang="en">English</contributor><contributor type="oppiainekoodi">301</contributor><subject type="yso">retoriikka</subject><subject type="yso">rap</subject><subject type="yso">hip hop</subject><subject type="yso">rhetoric</subject><subject type="yso">rap music</subject><subject type="yso">hip hop</subject><available>2022-05-24T07:24:30Z</available><issued>2022</issued><type lang="en">Bachelor's thesis</type><type lang="fi">Kandidaatinty&#xF6;</type><identifier type="uri">https://jyx.jyu.fi/handle/123456789/81247</identifier><identifier type="urn">URN:NBN:fi:jyu-202205242877</identifier><language type="iso">en</language><rights type="copyright" lang="fi">Julkaisu on tekij&#xE4;noikeuss&#xE4;&#xE4;nn&#xF6;sten alainen. Teosta voi lukea ja tulostaa henkil&#xF6;kohtaista k&#xE4;ytt&#xF6;&#xE4; varten. K&#xE4;ytt&#xF6; kaupallisiin tarkoituksiin on kielletty.</rights><rights type="copyright" lang="en">This publication is copyrighted. You may download, display and print it for Your own personal use. Commercial use is prohibited.</rights><permaddress type="urn">http://www.urn.fi/URN:NBN:fi:jyu-202205242877</permaddress><file bundle="ORIGINAL" href="https://jyx.jyu.fi/bitstream/123456789/81247/1/URN%3aNBN%3afi%3ajyu-202205242877.pdf" name="URN:NBN:fi:jyu-202205242877.pdf" type="application/pdf" length="706481" sequence="1"/><recordID>123456789_81247</recordID></qualifieddc>
id jyx.123456789_81247
language eng
last_indexed 2024-09-03T10:51:49Z
main_date 2022-01-01T00:00:00Z
main_date_str 2022
online_boolean 1
online_urls_str_mv {"url":"https:\/\/jyx.jyu.fi\/bitstream\/123456789\/81247\/1\/URN%3aNBN%3afi%3ajyu-202205242877.pdf","text":"URN:NBN:fi:jyu-202205242877.pdf","source":"jyx","mediaType":"application\/pdf"}
oppiainekoodi_txtF 301
publication_first_indexed 2022-05-24T20:00:30Z
publishDate 2022
record_format qdc
source_str_mv jyx
spellingShingle Vainio, Otto ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech retoriikka rap hip hop rhetoric rap music
subject_txtF Englannin kieli
thumbnail https://jyu.finna.fi/Cover/Show?source=Solr&id=jyx.123456789_81247&index=0&size=large
title ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech
title_full ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech
title_fullStr ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech
title_full_unstemmed ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech
title_short ”When I talk, it’s not a rant. It’s a symphony of ideas”
title_sort when i talk it s not a rant it s a symphony of ideas a study on the rhetorical devices in kanye west s speech
title_sub a study on the rhetorical devices in Kanye West’s speech
title_txtP ”When I talk, it’s not a rant. It’s a symphony of ideas” : a study on the rhetorical devices in Kanye West’s speech
topic retoriikka rap hip hop rhetoric rap music
topic_facet hip hop rap rap music retoriikka rhetoric
url https://jyx.jyu.fi/handle/123456789/81247 http://www.urn.fi/URN:NBN:fi:jyu-202205242877
work_keys_str_mv AT vainiootto whenitalkitsnotarantitsasymphonyofideasastudyontherhetoricaldevicesinkanyewestsspeech